DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and K02H11.4

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_503439.2 Gene:K02H11.4 / 186913 WormBaseID:WBGene00019348 Length:504 Species:Caenorhabditis elegans


Alignment Length:305 Identity:58/305 - (19%)
Similarity:99/305 - (32%) Gaps:117/305 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 VHPNITKVLNHY-----EQEGKVQVIPL-----------TLPGGQPNVPGFQHLYLTKKTNHKRQ 347
            :|..:|.:|..|     |.| |:..:.|           .|...:||            :|.:.:
 Worm   196 LHLYVTSMLESYFDLVLEYE-KLGYVTLDFWMRYNFANSALNSPEPN------------SNVEWR 247

  Fly   348 NEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMD------KVR----PESRKIKPD 402
            |:...:.|||.:......:|...|:|:|::|:|....:.|...      .:|    |:...:   
 Worm   248 NQAGAHTDCLLQYKEAAKFITFADLDDVLIPRGYETYFHEFASLFYFHPNIRTFQYPKQEMM--- 309

  Fly   403 GFHSY-NFRNVYFLDDQQHEHGWHKDI---------PKYMHMLQHVHRAKNYTKPNQYVKCFHDP 457
             ||:. |..:.:.:  :|..|.|..:.         |..::.: .:||:.|....|..|      
 Worm   310 -FHNKPNISDFHMI--EQFSHSWFANTQATGKIVARPSDLNSM-WIHRSFNVPDKNFQV------ 364

  Fly   458 ERVLTLHNHFPLSCLGGVCKSYPVDTKDAQ----------------------LQHYRADCVKTLK 500
                ..||.|       :....|||| |.|                      :|..:.|.||.|.
 Worm   365 ----VSHNFF-------IHLQRPVDT-DGQDPITYEMRSFSIAKHLKLNASVMQPVQEDFVKVLN 417

  Fly   501 KS---------------------CEEYREHSVEDKTIWKYKDELI 524
            .|                     |...:.::.:|.|....:|.||
 Worm   418 SSRYQKITAKLPKNTYYFPILFRCYYEKYYNAQDDTCPNGEDCLI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 58/305 (19%)
K02H11.4NP_503439.2 Glyco_transf_92 165..416 CDD:366762 50/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.