DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and F49C12.5

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_501627.1 Gene:F49C12.5 / 186028 WormBaseID:WBGene00009875 Length:507 Species:Caenorhabditis elegans


Alignment Length:282 Identity:63/282 - (22%)
Similarity:108/282 - (38%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 CQIPKPFHGV--VPS--SVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVR 276
            |||...|..|  :|:  |:.||      :.|.|..|....|...|:...||...| |:.:     
 Worm   116 CQIITVFATVQLLPNVKSIKMV------SGNELTEIPFSKPSSLKRDVVVCTSPL-FVSE----- 168

  Fly   277 LIEWIEMLNILGADKIY-----FYNLQVHPNIT---KVLNHYEQEGKVQVIPLTLPGGQPNVPGF 333
              :|   .|.|.|..||     ..||.:..:||   :::..||:||.:.:.|..    ....|..
 Worm   169 --QW---QNFLFAVHIYKKFDAHMNLYLVSSITSFYELMKEYEKEGYMTIQPWV----SVKYPEV 224

  Fly   334 QHLYLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMDKVRPESRK 398
            ..:........:.:|:.....|||.:......:|..||:|:|::|| .|..::|...|:....::
 Worm   225 SKIIADSYDQIEFRNQAAAQTDCLLQFKESARFITFLDLDDVLIPK-LAPTYAEEFQKLMVTKKR 288

  Fly   399 IKPDGFHSYNF-------------RNVYFLDDQQHEHGWHKDI--PKYMHMLQHVHRAKNYT--- 445
            .....:|..|:             :|::...:.|:.....|.:  ||::          |:|   
 Worm   289 SSFIFYHKENYNVAATRYGSKFSLKNMFNSMECQNNRETGKIVVNPKHL----------NFTWIH 343

  Fly   446 ----KPNQYVKCFHD-PERVLT 462
                .|.:..|  |: .|.|:|
 Worm   344 YPPISPEELAK--HEVTENVIT 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 49/237 (21%)
F49C12.5NP_501627.1 Glyco_transf_92 155..412 CDD:279961 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.