DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and F36F12.3

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001300099.1 Gene:F36F12.3 / 185362 WormBaseID:WBGene00018094 Length:251 Species:Caenorhabditis elegans


Alignment Length:269 Identity:49/269 - (18%)
Similarity:112/269 - (41%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 VRLIEWIEMLNILGADKIYF--YNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLY 337
            ::|:|::|.:.|......:|  :::..:..:  .|:.||::|..:...:                
 Worm    14 LQLVEFVEHMRIFEVSMFFFTVFDMDAYSRL--ALDEYERQGIAETTVI---------------- 60

  Fly   338 LTKKTNHKRQN---EVIPYNDCLYKNLYLYDYIALLDIDE---VIMPKGGAVLWSELMDKVRPES 396
               :|.:::.:   .::..:||.:::.|:..::...||||   :..|:      :.|:..:|.:.
 Worm    61 ---QTEYEQLDWMFHLLQLHDCFHRSKYISRWVINADIDERFVMFQPE------TTLIQLLRSQD 116

  Fly   397 RKIKPDGFHSYNFRNVYFLDDQQHEHGWHKDIPKYMHMLQHVHRAKNYTKPN--QYVKCFHDPER 459
            ..:   |..::..|.:...::...:....:|..:.:..|    :.:|.|:..  :..|..:.||.
 Worm   117 ANV---GELNFQARRIQKTENSPQKFTNLQDTIENLEAL----KFRNTTRTQIWESSKSIYRPEM 174

  Fly   460 V-LTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRADCVKTLKKSCEEYREHSVEDKTIWKYKDEL 523
            | :..::|..|...|.:.|:.|.:|  |..:|||...|:           :|:.:.  |.|.|..
 Worm   175 VAVQTYHHTHLQYPGVIVKNVPRET--AGFRHYRMTSVR-----------NSIGNG--WIYGDNF 224

  Fly   524 IRRTIKALD 532
               ||..||
 Worm   225 ---TITELD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 45/262 (17%)
F36F12.3NP_001300099.1 Glyco_transf_92 1..237 CDD:366762 49/269 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.