DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C35A5.5

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_505695.4 Gene:C35A5.5 / 183223 WormBaseID:WBGene00007949 Length:520 Species:Caenorhabditis elegans


Alignment Length:267 Identity:50/267 - (18%)
Similarity:91/267 - (34%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 VHPNITKVLN-------HYEQEGKVQV---IPLTLPGG-----QPNVPGFQHLYLTKKTNHKRQN 348
            :|..:|.:::       .||:.|.|.:   :.|.|...     :||:            :.:.:|
 Worm   211 LHMYVTSIIDTFFDLVQEYERLGYVTIDYWMRLKLANSSVDSVEPNL------------HSELRN 263

  Fly   349 EVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSEL--MDKVRP----------ESRKIKP 401
            :....:||||:......:|...|:|::.:|:|....:.|.  :.::.|          |:.....
 Worm   264 QAGAQSDCLYQYKEAAAFITFFDLDDIFIPRGYDSYFDEFSALYELHPNILTFQYTKRETMVYNK 328

  Fly   402 DGFHSYNFRNVYFLDDQQHEHGWHKDIPKYMHMLQHVHRAKNYTKP-NQYVKCFHDPERVLTLHN 465
            ......||..::       .|.|..:...|         .|..||| |......|:...:.|..:
 Worm   329 AKIEDINFEELF-------GHTWFVNEEDY---------GKVMTKPGNLNSMWIHESWNIPTNRH 377

  Fly   466 HFPLSCLGGVCKS-------YPVDTKDAQLQHYRADCVKTLKKSCEEYREHSVEDKTIWKYKDEL 523
            |        |.||       .|||........||....:.|:..       .:...|:...:|:|
 Worm   378 H--------VSKSNYIIHMQKPVDPDGTDPVSYRMSNFEMLESM-------QLNASTLIPIQDDL 427

  Fly   524 IRRTIKA 530
             .|.:|:
 Worm   428 -ERVLKS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 48/262 (18%)
C35A5.5NP_505695.4 Glyco_transf_92 181..431 CDD:279961 49/263 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.