DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C18G1.6

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_504276.1 Gene:C18G1.6 / 182796 WormBaseID:WBGene00015984 Length:464 Species:Caenorhabditis elegans


Alignment Length:492 Identity:83/492 - (16%)
Similarity:169/492 - (34%) Gaps:122/492 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YWSKNKNFLQQKSSTCAKYPSIFELEFNNIYWQTLRTS--NGTFQL---FGAYYDIRRTSLLGPT 157
            |::.:...:||          :.:|.:::....|:.|.  |.:|.:   ..||.|.|..:   |.
 Worm    21 YFASSGRNVQQ----------VQQLAYSDKESLTINTDQINSSFPIKFYHNAYVDYRYET---PR 72

  Fly   158 VRILGMIDRIEPKVKTYCQFWFDGQKEPFIVKTFEYKYIWYNKWGNYKQG----IYQPYLIACQI 218
            :||..:...|..|.......:::|.:.|..:|.:          |...:|    .|.|......:
 Worm    73 LRIFALSRCITKKDFLSVDLFYEGIEIPTNLKVY----------GESLEGSCPSTYGPAKPCFYV 127

  Fly   219 PKPFHGVVPSSVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEM 283
            ...|...:..:..:.:...:.....:.:.........:||..:|::.: :.|.... .::.:||.
 Worm   128 AHTFFANITVTGGLNKVTINLGNRKVNLTVKEIDKRYEKGLTMCLQPV-YYYSQWQ-NIVLYIEA 190

  Fly   284 LNILGADKIYFYNLQVHPNITKVLNHYEQEGKVQV--------IPLTLPGGQPNVPGFQHLYLTK 340
            ....||.:...:......:..|||::|...|.:::        :|:.:....|.:          
 Worm   191 WKAHGASRFIVFFHSATKDTWKVLDYYRNLGILEIRSWPSFGNLPVQIADKYPKI---------- 245

  Fly   341 KTNHKRQNEVIPYNDCLYKNLYLYDYIALL----DIDEVIMPKGGAVLWSELMDKVRPESRKIKP 401
                  .:.|..::..|..||.:.|....:    |.|||::|:.|.:|     |....|....| 
 Worm   246 ------DDSVFIFSYFLAMNLCILDIKTTIGTVADFDEVMVPRNGTML-----DYALKEMTGTK- 298

  Fly   402 DGFHSYNFRNVYF-LDDQQHEHGWH----------KDIPKYMHMLQHVHRAKNYTKPNQYVKCFH 455
              ..:.:|.|.|. ::...:::|:.          ....||:.....:..|:.:     :||.|.
 Worm   299 --VGALSFGNNYVAMEPSIYDNGFSGVSEPVFLDGGGPSKYVFNASVIDIAQVH-----WVKSFL 356

  Fly   456 DPERV------LTLHNHFPLSCLGGVCKS---YPVDTK--------------DAQLQHYRAD--- 494
            ||.:.      ..||..|.......|.|.   :|.::.              :..|..:.:|   
 Worm   357 DPTKTTKGSNGALLHLRFGAKGKKKVKKPFTFFPDNSSHHVRNMQETATAIFNGSLPKFSSDLID 421

  Fly   495 ----CVKTLKKSCEEYR------EHSVEDKTIWKYKD 521
                ||:.::|.....|      ...::|.|.|.|.:
 Worm   422 GINSCVEKIRKKPNTCRSTGGMCRSQMDDLTEWIYDE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 58/324 (18%)
C18G1.6NP_504276.1 Glyco_transf_92 166..408 CDD:366762 48/272 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.