DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C13A2.5

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_504849.2 Gene:C13A2.5 / 182553 WormBaseID:WBGene00015722 Length:536 Species:Caenorhabditis elegans


Alignment Length:293 Identity:58/293 - (19%)
Similarity:102/293 - (34%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 EW------IEMLNILGADKIYFYNLQVHPNITKVLNHYEQEGKVQVIP-LTLPGGQPNVPGFQHL 336
            :|      :.:.:..||..| .|...:..:..:::..||:.|.:.:.. |.:....|..|.|:  
 Worm   203 QWEIFVFHVHVAHRFGAHMI-IYLTSIVDSYFELMQEYERIGYITIEKWLKMKFNNPETPFFE-- 264

  Fly   337 YLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMDKV--------- 392
               ...|.:.:|:...:.|||.:......:|:..|:|::::|......:.|...:.         
 Worm   265 ---PNLNTELRNQAGAHADCLLQYKEAAQFISFFDMDDILVPLNYPTYFQEFTHEFNKNPGARSI 326

  Fly   393 ---RPESRKIKPDGFHSYNFRNVYFLDDQQHEHGWHKDIPK-----YMHMLQHVHRAKNYTKPNQ 449
               |.|.|..|...|..:||..:.    |..|....| .||     .::....:|.:|....||:
 Worm   327 FYGRREHRFTKGGSFSKFNFHEIV----QSLESSLTK-APKPVIKPELYNSMGIHGSKRDRNPNK 386

  Fly   450 YVKCFHDPERVLT----------LHNHFPLSCLGGVCKSYPVDTKDAQLQHYRADCVKTLKKSCE 504
              :.|     .||          :|...|:.      |..|.|..  ||..:......      |
 Worm   387 --QAF-----TLTGGPLITVPSIIHVQRPIG------KDGPSDVH--QLWKFEFGPFN------E 430

  Fly   505 EYREHSVE--DKTIWKYKDELIRRTIKALDTLG 535
            ..:::.||  :..||:.      |.|.|...||
 Worm   431 TIQDNDVEALENDIWRI------RNISAFAQLG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 53/283 (19%)
C13A2.5NP_504849.2 Glyco_transf_92 189..448 CDD:366762 53/282 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.