DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C13A2.1

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_504854.4 Gene:C13A2.1 / 182549 WormBaseID:WBGene00015718 Length:498 Species:Caenorhabditis elegans


Alignment Length:263 Identity:51/263 - (19%)
Similarity:93/263 - (35%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 VVPSSVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGA 289
            ::|:    |||....:.:.:..|....|....:...|||..| |:.:       :|   .|.|.|
 Worm   120 LIPN----VEKIKMVSDDGMTEIPFTKPSYVNRDVVVCVAPL-FVSE-------QW---QNFLFA 169

  Fly   290 DKIY-----------------FYNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLY 337
            ..||                 ||||         :..||:.|.:.:.|..    .....|.....
 Worm   170 VHIYKKYGAFVNLYLISAVNTFYNL---------MKEYEEAGYLSIKPWV----YVKFSGIPKAI 221

  Fly   338 LTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMDKVRPESRKIKPD 402
            ....:..:.:::....:|||.:......:|...::::||:|            ::.|...|....
 Worm   222 ADTNSQIELRSQAAAQSDCLLQYKEAAKFIMFFELEDVIIP------------RLAPTYVKEFQQ 274

  Fly   403 GFHSYNFRNVYFLDDQQHEHGWHKDIPKY--MHMLQHVHRAKNYTKPNQYVKCFHDPERVLTLHN 465
            .|:|.....:|:    |.|: ::..:.:|  ...|:::..:..|....:..|...||.||.....
 Worm   275 LFNSDQLSYIYY----QREN-YNAVVTRYGGRFSLKNMFGSLTYKNFREAGKSVVDPLRVNYTSL 334

  Fly   466 HFP 468
            |||
 Worm   335 HFP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 45/231 (19%)
C13A2.1NP_504854.4 Glyco_transf_92 148..403 CDD:366762 45/231 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.