DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and K08D9.6

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_503885.2 Gene:K08D9.6 / 178760 WormBaseID:WBGene00019527 Length:530 Species:Caenorhabditis elegans


Alignment Length:349 Identity:58/349 - (16%)
Similarity:123/349 - (35%) Gaps:96/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IPKPFHGVVPSSVSMVEK----ECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLI 278
            :|...:..|.:..:.::.    |.:.:.|.:.:.:........|...:|:.. .|:.:...:.::
 Worm   143 VPSCRYTTVMAKTTTIDNLSKFEMEISGNTVEIPFKMARYTAPKPVIICISP-QFVAEQWQIFMM 206

  Fly   279 EWIEMLNILGADKIYFYNLQVHPNITKVLNHYEQEG--------KVQVIPLTLPGGQPNVPGFQH 335
            : :.:.:..|. .::.|...:..:...::..||:..        :::......|..:||    :|
 Worm   207 Q-VHVAHRFGG-HLHIYLTSIVESFFNLMREYEKRKYLTLDFWLRMKFTDTKTPFFEPN----RH 265

  Fly   336 LYLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMD--KVRPESRK 398
            :        :.:|:.....|||.:.....::||..|:|:::.||.......|...  :|.|.|..
 Worm   266 V--------EWRNQAGAQIDCLLQYKEAAEFIAFFDMDDILFPKTYPTYLQEFRAEWEVDPTSNS 322

  Fly   399 I----------KPDGFHSYNFRNVYFLDDQQHEHGWHKDIPKYMHMLQHVHRAKNYTKPNQYVK- 452
            |          |...|.::||                |:|...:.....|.|.|...||.:|.. 
 Worm   323 IFYGRREHEFVKAKSFKTFNF----------------KEIVSTLESSDTVKRGKVVVKPERYNST 371

  Fly   453 ----CFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRADCVKTLKKSCEEYREHSVED 513
                .:||..|                     .:.....|.|        :::..||...:.:.|
 Worm   372 WIHYSWHDANR---------------------REIVSPNLVH--------VQRPLEEDSNNEMTD 407

  Fly   514 KTIWKYK----DELIRRT-IKALD 532
              :|:.:    :|.||:: |||:|
 Worm   408 --VWQMEFGVLNETIRQSDIKAID 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 50/298 (17%)
K08D9.6NP_503885.2 Glyco_transf_92 186..435 CDD:366762 54/306 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.