DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and F36F12.1

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_503571.1 Gene:F36F12.1 / 178691 WormBaseID:WBGene00018092 Length:518 Species:Caenorhabditis elegans


Alignment Length:157 Identity:31/157 - (19%)
Similarity:63/157 - (40%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFY 295
            ||.:.|.:|....:...::.|.....|....|:..| |..:.....|:: :::.|..|| .::.|
 Worm   140 SMSKLEIETRNGLVTFPFSEPKVQSTKPVVFCIAPL-FASEQWQSFLMQ-LQVSNKFGA-HLHVY 201

  Fly   296 NLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPYNDCLYKN 360
            .:.:..|..:::....|.|    |..|.|...|........:|....|.:.:|....:.|||.:.
 Worm   202 MMTMLENYYQMVRELGQLG----IVTTQPWLTPKFSQVARPFLEPSRNSELRNPAAAFTDCLLQY 262

  Fly   361 LYLYDYIALLDIDEVIMPKGGAVLWSE 387
            .....:|..::|::::.|......:.|
 Worm   263 KEAAQFIGFMEIEDLLFPLNTLTYYEE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 26/131 (20%)
F36F12.1NP_503571.1 Glyco_transf_92 166..432 CDD:366762 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.