DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and T15D6.12

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_493143.1 Gene:T15D6.12 / 173110 WormBaseID:WBGene00011786 Length:459 Species:Caenorhabditis elegans


Alignment Length:406 Identity:80/406 - (19%)
Similarity:148/406 - (36%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SIFELEFNNIYWQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMIDRIEPKVKTYCQFWFDGQ 182
            |.|.::|.|:                ||.|.|..|   |.:||..:...|..|.......::.|.
 Worm    45 SSFPIKFYNV----------------AYVDYRYDS---PRLRIFTLNHCISKKNFLSVDLYYKGI 90

  Fly   183 KEPFIVKTFEYKYIWYNKWGNYKQGIYQPYLIACQIPKPFHGVVPS--------------SVSMV 233
            ..|..:|.       |.|  :.::.....|:.|    ||...|..:              ::::.
 Worm    91 SSPTKLKV-------YGK--SLEETCPSSYIFA----KPCFYVAHTFFANLELNGRLEKVTINLG 142

  Fly   234 EKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFYNLQ 298
            ::|.:.|   ::.:|.:    .:||..:|::.: :.|.... .::.:||.....||.:...|...
 Worm   143 DREVNLA---VKEVYKK----HEKGLTLCLQPV-YYYSQWQ-NIVLYIEAWRAHGASRFIVYYHS 198

  Fly   299 VHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPYNDCLYKNLYL 363
            ...:..|||.:|...|.:::.|....|..|  |..:..|      .|..:.|..::..|..||.:
 Worm   199 ATKDTWKVLEYYRDMGIIEIRPWPNFGSLP--PQIEKKY------PKIDDSVYGFSYFLALNLCI 255

  Fly   364 YDYI----ALLDIDEVIMPKGGAVLWSELMDKVRPESRKIKPDGFHSYNFRNVYF-LDDQQHEH- 422
            .|..    ::.|.|||::|..|.:|        ...|:::......:..|:|.|. |:...::: 
 Worm   256 LDIKTTIGSVADFDEVMVPHNGTML--------EYASKEMTGTNVGALLFKNSYVSLEPSIYDNE 312

  Fly   423 --GWHKDI-------PKYMHMLQHVHRAKNYTKPNQYVKCFHDPERVLTLHNHFPLSCLGGVCKS 478
              |..|.:       |||:.....:..|:.:     :|:.|.|..:      |..:|        
 Worm   313 FTGVSKPVFLDGTAAPKYVFNATVIDIAQTH-----WVRSFTDSTK------HTKVS-------- 358

  Fly   479 YPVDTKDAQLQHYRAD 494
                  |..|.|:|.|
 Worm   359 ------DGTLLHHRFD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 53/253 (21%)
T15D6.12NP_493143.1 Glyco_transf_92 159..395 CDD:366762 53/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.