DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and F13G3.3

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_492062.1 Gene:F13G3.3 / 172475 WormBaseID:WBGene00008763 Length:501 Species:Caenorhabditis elegans


Alignment Length:339 Identity:63/339 - (18%)
Similarity:126/339 - (37%) Gaps:74/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 VVPSSVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGA 289
            |:..|:.:|....:.|.....|:.:.|     |...:|:..| |..::....|:. :.:..|.||
 Worm   124 VLNPSLLLVSLGGNHAPIPFEVVSSEP-----KPVVMCISPL-FAAENWHNLLVS-LHVYKIFGA 181

  Fly   290 DKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTL-PGGQPNVPGFQHLYLTKKTNHKRQNEVIPY 353
             .::.|...:...:.::|..|||||..     || |..:.|:............|.:.:::....
 Worm   182 -HMHLYIRSIVSPMLEILRVYEQEGYA-----TLKPWNRINLLNRDEQDFNPNLNVEFRSQAAAQ 240

  Fly   354 NDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMDKVRPESRKIKPD----GFHSYNFRNVYF 414
            .|||.:.....:::|.:|:|::|:|:        :.|....|.|.:..:    .:.:|:..|.  
 Worm   241 TDCLLRYKESSEFVAFVDLDDLIIPR--------VADNYASEFRYLASEHPTVAYFTYSKENT-- 295

  Fly   415 LDDQQHEHGWHKDIPKY----MHMLQHVHRAKNYTKPNQYVKCFHDPERVLTLHNHFPLSCLGGV 475
                        .|..|    :..::||.|...:.:..:..|....|.::.....|:|...|   
 Worm   296 ------------RIKAYKRANVFSIEHVLRNIKHEQQTETGKMIAIPSKINNTWIHWPQKNL--- 345

  Fly   476 CKSYPVDTKDAQLQHYR-ADCVKTLKKSCEEYREHS-----------VEDKTI-----------W 517
             |...|..:...:.|.: .:.:..||...||..:::           :.:|.|           |
 Worm   346 -KKLAVKPEFNSITHLKHIELLDGLKSKNEEEPKYNPSTGLDNDKPLISNKNIKMIEKDFNRMSW 409

  Fly   518 KYKDELIRRTIKAL 531
            |   ..:||.::.|
 Worm   410 K---SSVRRHLRNL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 55/301 (18%)
F13G3.3NP_492062.1 Glyco_transf_92 151..407 CDD:279961 52/289 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.