DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and LOC100536206

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_009302352.1 Gene:LOC100536206 / 100536206 -ID:- Length:260 Species:Danio rerio


Alignment Length:276 Identity:67/276 - (24%)
Similarity:118/276 - (42%) Gaps:51/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 IEMLNILGADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTL-----PGGQPNV---PGFQHLY 337
            :||..:||...:..|......::.|:|.:||.||.::::...:     |....|.   .|..|.|
Zfish    14 MEMYKLLGVQHVVLYKTSCGKDLEKLLKYYESEGILEIVSWPINKFLNPSSGWNFQEHKGDLHYY 78

  Fly   338 LTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWS--ELMDKVRPESRKIK 400
                      .:::..|:|:|:::|...|:.|.||||:|||.....|.:  |.:....|      
Zfish    79 ----------GQLVTLNECIYRHMYQSKYVLLNDIDEIIMPYKHTNLQALMEYLQSTHP------ 127

  Fly   401 PDGFHSYNFRNVYFLDDQQHEHG------WHKDIPKYMHMLQHVHRA---KNYTKPNQYVKCFHD 456
              |...::.::..|...|..|.|      |: :||. :::::|::||   ||...|   .|...:
Zfish   128 --GASVFHVKSHLFPTTQFEESGKFKRKEWN-NIPG-VNIMEHIYRAPEPKNVYNP---AKMIIN 185

  Fly   457 PERVLTLHNHFPLSCLGGVC-KSYPVDTKDAQLQHYRADCVKTLKKSCEEYREHSVEDKTIWKYK 520
            |.:|.....|..|...|..| .::.|    :::.|.|    :..:......:|..:.||.:|.:|
Zfish   186 PRKVEQTSVHSSLKHSGYYCFVAFDV----SRMIHVR----EPFQNGANLTKEQLLVDKRVWDFK 242

  Fly   521 DELIRRTIKALDTLGF 536
            .|||....:.|...||
Zfish   243 HELIPNVDRTLKLSGF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 64/265 (24%)
LOC100536206XP_009302352.1 Glyco_tranf_GTA_type 1..220 CDD:325014 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.