DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and si:ch73-211l2.1

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_002663252.1 Gene:si:ch73-211l2.1 / 100334791 ZFINID:ZDB-GENE-081105-10 Length:436 Species:Danio rerio


Alignment Length:435 Identity:99/435 - (22%)
Similarity:171/435 - (39%) Gaps:99/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LFGAYYDIRRTSLLGPTVRILGMIDR--IEPKVKTYCQFWFDGQKEPFIVKTFEYKYIWYNKWGN 203
            :..|:.|.|    |...:|::.:|.|  ::|....||       ....:.:|.|           
Zfish    61 MVSAFIDHR----LDGAIRVISIIKRNNLQPLYCVYC-------TPEHVCETVE----------- 103

  Fly   204 YKQGIYQPYLIACQIPKPFHGVVPSSVSMVEKECDTATN------------NLRVIY-----NRP 251
                 .:..:.|.....|||   .|.|....|...:|::            ||::.|     |..
Zfish   104 -----TEVQIHADHFGFPFH---VSDVICKGKNMQSASHVLITTHPTKNSYNLKIDYLLIKNNVV 160

  Fly   252 PDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFYNLQVHPNITKVLNHYEQEGKV 316
            .|:.|..|.||:..|...|::: ::..:.:||..:||...:..|.....|::.|:|.|||.||.:
Zfish   161 TDNFKYNFTVCISNLFGSYNNI-LQFAQTMEMYKLLGIQHVVIYKTSSGPDLKKLLKHYESEGLL 224

  Fly   317 QVIP------LTLPGGQPNVPGFQ------HLYLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIAL 369
            :::.      |....|.    .||      |.|          .:::..|:|:|:::|...|:.|
Zfish   225 EIVSWPIDKFLNASSGW----NFQEHKGDLHYY----------GQLVTLNECIYRHMYQSRYVLL 275

  Fly   370 LDIDEVIMPKGGAVLWSELMDKVRPESRKIKPDG---FHSYNFRNVYFLDDQQHEHGWHKDIPKY 431
            .||||:|||...:.|.|.:.|....:..|    |   ..::.|....|.|..:.:....|:|.. 
Zfish   276 NDIDEIIMPYKYSNLQSLMEDLQSADPSK----GVFIIENHVFPKTQFEDSGKFKRKEWKNIAG- 335

  Fly   432 MHMLQHVHR---AKNYTKPNQYVKCFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRA 493
            :::::|::|   .||...|   .|...:|.:|.....|..|...|   :||.|.....::.|.|.
Zfish   336 INIMEHIYREPERKNVYNP---AKMIVNPRKVEQTSVHSSLMIFG---ESYHVPFNVCRIVHVRE 394

  Fly   494 DCVKTLKKSCEEYREHSVEDKTIWKYKDELIRRTIKALDTLGFFR 538
            ....:|.|      |....||.:|.::.:||....:.|...|..:
Zfish   395 PLQGSLTK------EELFIDKRVWDFEKDLIPNVDRTLKLSGLLK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 71/287 (25%)
si:ch73-211l2.1XP_002663252.1 Glyco_transf_92 166..419 CDD:279961 69/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.