DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and LOC100331417

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_021327770.1 Gene:LOC100331417 / 100331417 -ID:- Length:253 Species:Danio rerio


Alignment Length:273 Identity:64/273 - (23%)
Similarity:116/273 - (42%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 WIEMLNILGADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTL-----PGGQPNV---PGFQHL 336
            ::..:|:.|   |..|......::.|:|.:||.||.::::...:     |....|.   .|..|.
Zfish     9 FLSFVNLFG---ITVYKTSCGKDLEKLLKYYESEGILEIVSWPINKFLNPSSGWNFQEHKGDLHY 70

  Fly   337 YLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMP--KGGAVLWSELMDKVRPESRKI 399
            |          .:::..|:|:|:::|...|:.|.||||:|||  ........|.:....|.:   
Zfish    71 Y----------GQLVTLNECIYRHMYQSKYVLLNDIDEIIMPYKHNNLQALMEYLQSTHPGA--- 122

  Fly   400 KPDGFH--SYNFRNVYFLDDQQHEHGWHKDIPKYMHMLQHVHRA---KNYTKPNQYVKCFHDPER 459
              ..||  |:.|....|.:.::.:.....:||. :::::|::||   ||...|   .|...:|.:
Zfish   123 --SVFHVKSHLFPTTQFEESRKFKRKEWNNIPG-VNIMEHIYRAPEPKNVYNP---AKMIINPRK 181

  Fly   460 VLTLHNHFPLSCLGGVC-KSYPVDTKDAQLQHYRADCVKTLKKSCEEYREHSVEDKTIWKYKDEL 523
            |.....|..|...|..| .::.|    :::.|.|    :..:......:|..:.||.:|.:|.||
Zfish   182 VEQTSVHSSLKYSGYYCFVAFDV----SRMIHVR----EPFQNGANLTKEQLLVDKRVWDFKHEL 238

  Fly   524 IRRTIKALDTLGF 536
            |....:.|...||
Zfish   239 IPNVDRTLKLSGF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 61/262 (23%)
LOC100331417XP_021327770.1 Glyco_tranf_GTA_type 7..213 CDD:325014 53/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.