DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14629 and CG9917

DIOPT Version :9

Sequence 1:NP_569881.1 Gene:CG14629 / 31055 FlyBaseID:FBgn0040398 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001259605.1 Gene:CG9917 / 32596 FlyBaseID:FBgn0030740 Length:301 Species:Drosophila melanogaster


Alignment Length:308 Identity:112/308 - (36%)
Similarity:176/308 - (57%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLAFAVHAVLGSVDLAGSLDPSLLENVDVDQLRSNYLPQGLQNTNVTLADFQKWLQSKC-EKAND 73
            |:.||...::..:||              ||:::. ||..|:.:|.::.|.::..::|| |.|.:
  Fly    15 LVIFATAGIMAQLDL--------------DQIQTQ-LPDQLRKSNFSVNDAKELFRNKCIEVAGE 64

  Fly    74 HLPKGSVNASALSKSIEDAGIHLAECLSGLANMTEIQAEIEEASPKGDLDVVFEKYCLRLPQAKT 138
               :..|.|..   .||...:.|.|||:|:.|.|.:|.||:||||||:|||||.|||.|...|..
  Fly    65 ---EAGVEAYG---EIESGFMVLTECLNGIVNYTAMQQEIQEASPKGELDVVFNKYCSRRSNAVE 123

  Fly   139 CLKNFNDAILPCLTTDEKTHNAVLQRIADKLLEFICYKNGDQIALFIAEEGPECLQQSREGIANC 203
            |:..|...::|||..:|:....|:::|...||.|:|:|:||||||||||:||||::..::.|..|
  Fly   124 CVDAFTAKLVPCLVQEEREGQDVIKQIIQSLLNFVCHKDGDQIALFIAEKGPECIESQKDNIQQC 188

  Fly   204 LNSSFAGYLPKSISPEWD-----LPQLVLGPKQCVDLYAFETCTVSLLEKCDTITPSNIVESMFR 263
            :||:|:.||  ::|...|     :|:|.:|.|||.::...:.|.|..||:|..|||:|:|||||.
  Fly   189 VNSTFSEYL--NVSDLQDNRIRSMPKLTVGQKQCDEMLTLQACVVRKLEQCSDITPANLVESMFN 251

  Fly   264 YVRKESSCQPHIDRVKLQHRRALPLTSGSQSGSSVSLHLTWTSASLLM 311
            ::|.::.|:.:         :..||.:.:.||.|...|..||...:.:
  Fly   252 FIRNQTMCRDN---------QKSPLVAAAASGGSRVFHQVWTHVGIFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14629NP_569881.1 DUF1397 54..271 CDD:284559 93/222 (42%)
CG9917NP_001259605.1 DUF1397 44..259 CDD:284559 93/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27351
OrthoDB 1 1.010 - - D102615at50557
OrthoFinder 1 1.000 - - FOG0014278
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20997
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.