DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and AT1G73440

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_565064.1 Gene:AT1G73440 / 843678 AraportID:AT1G73440 Length:254 Species:Arabidopsis thaliana


Alignment Length:275 Identity:75/275 - (27%)
Similarity:116/275 - (42%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GQPGGEGHHLSSEKQQSTEQCRQRPRKKLTDK-QPQR-SAANSHPEQADADTDSSSCEGI----K 96
            |:..||......|...|:......|.|....| :.|| |....:..:.||...|.:.:.:    .
plant     4 GESEGESSGSERESSSSSSGNESEPTKGTISKYEKQRLSRIAENKARLDALGISKAAKALLSPSP 68

  Fly    97 VGQRRGTRVSYAQRNLHGAELEDYD---YDGEGEGEREEDGEEEEEEEESYDDYEQSSKPEGRRP 158
            |.::|  ||   :|| .|.|.:||.   .||        ||:|:::|.|..|:.|:.......:.
plant    69 VSKKR--RV---KRN-SGEEDDDYTPVIADG--------DGDEDDDEVEEIDEDEEFLCKRKNKS 119

  Fly   159 SARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLID-----------------GETLHKRR-- 204
            ||       |:||..:|:|...|    :.:|:..:.:|                 ..|:.|:|  
plant   120 SA-------SKRKVSSRKILNTS----VSLGEDDDDLDKAIALSLQGSVAGSDKEAATMKKKRPE 173

  Fly   205 CISKGQMR--EFREAFRLFDKDGDGCITKEELGTVMRSLGQFARV-------EELQEMLQEIDVD 260
            .:||.||.  |....|..||:.|.|.||       :|.:.:.|.|       ||||:|::..|:|
plant   174 LMSKTQMTQDELVMYFCQFDEGGKGFIT-------LRDVAKMATVHDFTWTEEELQDMIRCFDMD 231

  Fly   261 GDGNVSFEEFVDILS 275
            .||.:|.:||..|:|
plant   232 KDGKLSLDEFRKIVS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 24/68 (35%)
EF-hand_7 215..274 CDD:290234 22/65 (34%)
EFh 294..355 CDD:238008
EF-hand_7 295..355 CDD:290234
AT1G73440NP_565064.1 EF-hand_7 189..245 CDD:290234 22/62 (35%)
EFh 192..246 CDD:238008 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.