DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and AT1G18530

DIOPT Version :10

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_173288.1 Gene:AT1G18530 / 838434 AraportID:AT1G18530 Length:157 Species:Arabidopsis thaliana


Alignment Length:149 Identity:50/149 - (33%)
Similarity:87/149 - (58%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFV-DI 273
            |:|:.::.|..||.|.||.:|..||..::||||.....:::..:|..:|.:|:|.|.|:|.| .|
plant     4 QIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSNGNGFVEFDELVGTI 68

  Fly   274 LSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEV 338
            |.::..|   .|.:::|    |.:.|:.||:...|:|:|::|...:..:|:.|..:::.:||||.
plant    69 LPDLNEE---VLINSEQ----LLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEA 126

  Fly   339 DVDGDGRIDFYEFVHALGE 357
            |.:|||.|.|.||...:.:
plant   127 DTNGDGVISFGEFASIMAK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504 49/142 (35%)
AT1G18530NP_173288.1 PTZ00184 2..143 CDD:185504 50/145 (34%)

Return to query results.
Submit another query.