DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CALN1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_113656.2 Gene:CALN1 / 83698 HGNCID:13248 Length:261 Species:Homo sapiens


Alignment Length:249 Identity:74/249 - (29%)
Similarity:111/249 - (44%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GEGEGEREEDGE------EEEEEEESYDDYEQSSKPEGRRPSARTALSVRSRRKTKTRQICYASS 182
            |||:.|.|:.|:      .||.......|:....|......:|               .:.|..:
Human     8 GEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTA---------------GLLYKGN 57

  Fly   183 DLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARV 247
            .|...:..|.   |.|.|..   ||..::.|.|||||:.|:||:|.|:|:|||..|||||.....
Human    58 YLNRSLSAGS---DSEQLAN---ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSE 116

  Fly   248 EELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAF------RVFDKHN 306
            .||..::|.:|:||||.|.|:||:.||....      :||      |.||.|      .:|.:.:
Human   117 VELAIIMQRLDMDGDGQVDFDEFMTILGPKL------VSS------EGRDGFLGNTIDSIFWQFD 169

  Fly   307 RGYITASDLRAVL-QCLGEDLDEEDIEDMIKEV-----DVDGDGRIDFYEFVHA 354
            ...||..:|:.:| ....:.|..:|||::|...     :..|:.:.:| |.||:
Human   170 MQRITLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEF-EGVHS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 33/61 (54%)
EF-hand_7 215..274 CDD:290234 31/58 (53%)
EFh 294..355 CDD:238008 19/73 (26%)
EF-hand_7 295..355 CDD:290234 18/72 (25%)
CALN1NP_113656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 9/30 (30%)
PTZ00184 74..>184 CDD:185504 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.