DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CML43

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_199259.1 Gene:CML43 / 834473 AraportID:AT5G44460 Length:181 Species:Arabidopsis thaliana


Alignment Length:195 Identity:60/195 - (30%)
Similarity:92/195 - (47%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGC 228
            :.:.:.:|..:||    ||...|   ..|:| :...||:              .|.||||:.||.
plant     1 MEINNEKKKLSRQ----SSSFRL---RSPSL-NALRLHR--------------VFDLFDKNNDGF 43

  Fly   229 ITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKS-----GLSSA 288
            ||.|||...:..||..|...:|:..:..........:.|::|..:...:   |:|     |....
plant    44 ITVEELSQALSRLGLDADFSDLKSTVDSFIKPDKTGLRFDDFAALHKTL---DESFFGGEGSCCD 105

  Fly   289 DQEERELRDAFRVFDKHNRGYITASDLRAVLQCLG--EDLDEEDIEDMIKEVDVDGDGRIDFYEF 351
            ...|.:|.:||.|||:...|:|:|.:|:.||:.||  |..:.|.:|.||..||.:.|||:||:||
plant   106 GSPESDLEEAFNVFDEDGDGFISAVELQKVLKKLGLPEAGEIEQVEKMIVSVDSNHDGRVDFFEF 170

  Fly   352  351
            plant   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 18/61 (30%)
EF-hand_7 215..274 CDD:290234 18/58 (31%)
EFh 294..355 CDD:238008 28/60 (47%)
EF-hand_7 295..355 CDD:290234 28/59 (47%)
CML43NP_199259.1 PTZ00184 33..174 CDD:185504 50/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.