DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CML11

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_188933.1 Gene:CML11 / 821865 AraportID:AT3G22930 Length:173 Species:Arabidopsis thaliana


Alignment Length:150 Identity:75/150 - (50%)
Similarity:109/150 - (72%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270
            :::.|:.||:|||.|||||||||||.:||.||:|||.|....:|||:|:.|||.||:|.:.|.||
plant    28 LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF 92

  Fly   271 VDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMI 335
            :::::|.       |...|.:| ||::||:||||...|||:||:||.|:..|||.|.:|:::.||
plant    93 LNLMANQ-------LQETDADE-ELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMI 149

  Fly   336 KEVDVDGDGRIDFYEFVHAL 355
            ||.|:||||::::.|||..:
plant   150 KEADLDGDGQVNYDEFVRMM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 37/61 (61%)
EF-hand_7 215..274 CDD:290234 35/58 (60%)
EFh 294..355 CDD:238008 33/60 (55%)
EF-hand_7 295..355 CDD:290234 32/59 (54%)
CML11NP_188933.1 PTZ00184 27..170 CDD:185504 75/149 (50%)
EFh 35..97 CDD:238008 37/61 (61%)
EFh 108..170 CDD:238008 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.