DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cabp4

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_021334000.1 Gene:cabp4 / 797905 ZFINID:ZDB-GENE-081104-291 Length:268 Species:Danio rerio


Alignment Length:211 Identity:61/211 - (28%)
Similarity:108/211 - (51%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QSSKPEGRRPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMRE 213
            :.||..|.|.|:.:    :.||.::|..   .:|.:........|.:.|:.    |.:...::.|
Zfish    73 KDSKNSGHRGSSDS----QGRRGSRTFS---QNSAIAAAYTQYLNSLFGQD----RDLLPEELDE 126

  Fly   214 FREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMT 278
            ..|||:.||.|.||.:..:::...||::|......||.|::|:|.:...|:|.|::|.:::....
Zfish   127 LLEAFKEFDYDQDGYLHYKDVADCMRTMGYMPTEMELIEIIQQIKMKWGGHVDFDDFCELMGPRM 191

  Fly   279 YEDKS---GLSSADQEERELRDAFRVFDKHNRGYITASDLR-AVLQCLGEDLDEEDIEDMIKEVD 339
            ..:.:   ||       |||..||:.||....|.||..:|: :....|||.|.:.::|:::.::|
Zfish   192 LAETAHMVGL-------RELHCAFKQFDCDGDGRITFEELKESTKTLLGEKLKKGELEEILTDID 249

  Fly   340 VDGDGRIDFYEFVHAL 355
            ::|||.:||.|||..|
Zfish   250 LNGDGNVDFDEFVMML 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 21/61 (34%)
EF-hand_7 215..274 CDD:290234 20/58 (34%)
EFh 294..355 CDD:238008 24/61 (39%)
EF-hand_7 295..355 CDD:290234 23/60 (38%)
cabp4XP_021334000.1 EFh_PEF 130..265 CDD:330173 46/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4848
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.