DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Cabp4

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_036017598.1 Gene:Cabp4 / 73660 MGIID:1920910 Length:297 Species:Mus musculus


Alignment Length:266 Identity:86/266 - (32%)
Similarity:126/266 - (47%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SSCEGIKVGQRRGTRVSY---AQRNLHGAELEDYDYDGEGEGE---REEDGEEEEEEEESYDDYE 148
            |:.||..:.:||..:.|:   :|:...|.:......:..|..:   |.:.|:|           |
Mouse    25 SAAEGPALTRRRSKKESWHPGSQKASSGDQSSSQGSEASGSSKHPPRTKVGQE-----------E 78

  Fly   149 QSSKPEGRRPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMRE 213
            .||.| .|..|.|.:...||..:....|..|           ||.|  .....|.|.:...::.|
Mouse    79 PSSAP-ARPASHRHSHRHRSDPQQDAAQRTY-----------GPLL--NRMFGKDRELGPEELEE 129

  Fly   214 FREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMT 278
            .:.||..||.|.||.|...|||..||:||......||.|:.|.:.:...|.|.|||||:::|...
Mouse   130 LQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEEFVELISPKL 194

  Fly   279 YEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLR-AVLQCLGEDLDEEDIEDMIKEVDVDG 342
            .|:.:.:...    ||||.|||.|||...|.||.::|| |....|||.|:..::::|::|:|::|
Mouse   195 REETAHMLGV----RELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLREMDLNG 255

  Fly   343 DGRIDF 348
            ||.|||
Mouse   256 DGTIDF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 27/61 (44%)
EF-hand_7 215..274 CDD:290234 26/58 (45%)
EFh 294..355 CDD:238008 28/56 (50%)
EF-hand_7 295..355 CDD:290234 27/55 (49%)
Cabp4XP_036017598.1 PTZ00184 133..262 CDD:185504 57/133 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.