DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and TNNC2

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_003270.1 Gene:TNNC2 / 7125 HGNCID:11944 Length:160 Species:Homo sapiens


Alignment Length:150 Identity:64/150 - (42%)
Similarity:94/150 - (62%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSF 267
            |..:|:..:.||:.||.:||.||.|.|:.:|||||||.|||....|||..:::|:|.||.|.:.|
Human     9 RSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDF 73

  Fly   268 EEFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIE 332
            |||:.::.....||..|.|     |.||.:.||:||::..|||...:|..:.:..||.:.:|:||
Human    74 EEFLVMMVRQMKEDAKGKS-----EEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIE 133

  Fly   333 DMIKEVDVDGDGRIDFYEFV 352
            .::|:.|.:.||||||.||:
Human   134 SLMKDGDKNNDGRIDFDEFL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 32/61 (52%)
EF-hand_7 215..274 CDD:290234 30/58 (52%)
EFh 294..355 CDD:238008 25/58 (43%)
EF-hand_7 295..355 CDD:290234 24/57 (42%)
TNNC2NP_003270.1 PTZ00184 12..156 CDD:185504 63/146 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.