DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and ocm3

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001025657.1 Gene:ocm3 / 595049 XenbaseID:XB-GENE-5833501 Length:109 Species:Xenopus tropicalis


Alignment Length:105 Identity:26/105 - (24%)
Similarity:49/105 - (46%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASD 314
            :.::|...|:  |..:|.....:...:.::.||.||:....:  ::|..|.:.|:...|:|...:
 Frog     3 ITDILSAKDI--DAALSSVSAAESFQHKSFFDKCGLTGKSND--QVRKVFEILDRDKSGFIEEDE 63

  Fly   315 LRAVLQCLGED---LDEEDIEDMIKEVDVDGDGRIDFYEF 351
            |:..||....:   |...:.:..:|..|.||||:|...||
 Frog    64 LQLFLQNFKSNARALSAAETKAFLKAGDSDGDGKIGVDEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 4/24 (17%)
EF-hand_7 215..274 CDD:290234 4/23 (17%)
EFh 294..355 CDD:238008 18/61 (30%)
EF-hand_7 295..355 CDD:290234 18/60 (30%)
ocm3NP_001025657.1 EFh_parvalbumin_beta 9..109 CDD:319998 25/99 (25%)
EF-hand motif 9..38 CDD:319998 7/30 (23%)
EF-hand motif 43..72 CDD:319998 8/28 (29%)
EF-hand motif 82..109 CDD:319998 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.