DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and RCN3

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_024307388.1 Gene:RCN3 / 57333 HGNCID:21145 Length:365 Species:Homo sapiens


Alignment Length:421 Identity:84/421 - (19%)
Similarity:137/421 - (32%) Gaps:151/421 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAVSGDEPDEEQASAVVAEGEDQETQNQAMQDDGQPGGEGHHLSSEKQQSTEQCRQRPRKKLTDK 69
            ||...|.|.::      |.|..|......:         |..::.|..|.|.:..|....::.|:
Human    37 AAPLSDAPHDD------AHGNFQYDHEAFL---------GREVAKEFDQLTPEESQARLGRIVDR 86

  Fly    70 QPQRSAANSHPEQADADTDSSSCEGIKVGQRRGTRVSYAQRNLH---GAELEDYDYDGEGE-GER 130
            ..:         ..|.|      ..:.:.:.|.......||::.   .|..:.||.|.:|. |  
Human    87 MDR---------AGDGD------GWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVG-- 134

  Fly   131 EEDGEEEEEEEESYDDYEQSSKPEGRRPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLI 195
                 .||....:|..|....:                            ..|:|          
Human   135 -----WEELRNATYGHYAPGEE----------------------------FHDVE---------- 156

  Fly   196 DGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTV--------MRSL------GQFAR 246
            |.||.  ::.:::.:.|     ||:.|:|||...|:|||...        ||.:      .:|.|
Human   157 DAETY--KKMLARDERR-----FRVADQDGDSMATREELTAFLHPEEFPHMRDIVIALPGAKFPR 214

  Fly   247 --------VEE----------------LQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSS 287
                    |:.                |||.|:::|.:.||.|..||::           :.|.|
Human   215 EPLTLTPGVQPPPGARVIGPQPQCPFLLQETLEDLDRNKDGYVQVEEYI-----------ADLYS 268

  Fly   288 ADQEERE------LRDAFRVF-DKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDGDGR 345
            |:..|.|      .|..||.| |.:..|::..|::...:....:|....:...::.|.|.|.|||
Human   269 AEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGR 333

  Fly   346 IDFYEFV---------HALGEPEDSQENDDE 367
            :...|.:         .|....||...:.||
Human   334 LSKAEILGNWNMFVGSQATNYGEDLTRHHDE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 25/99 (25%)
EF-hand_7 215..274 CDD:290234 25/96 (26%)
EFh 294..355 CDD:238008 16/76 (21%)
EF-hand_7 295..355 CDD:290234 15/69 (22%)
RCN3XP_024307388.1 EFh_CREC_RCN3 44..348 CDD:320028 76/396 (19%)
EF-hand motif 44..73 CDD:320028 7/43 (16%)
EF-hand motif 79..110 CDD:320028 4/45 (9%)
EF-hand motif 117..146 CDD:320028 9/35 (26%)
EF-hand motif 167..196 CDD:320028 11/33 (33%)
EF-hand motif 204..270 CDD:320028 15/76 (20%)
EF-hand motif 282..311 CDD:320028 7/28 (25%)
EF-hand motif 318..348 CDD:320028 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.