DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CABP4

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_011543483.1 Gene:CABP4 / 57010 HGNCID:1386 Length:295 Species:Homo sapiens


Alignment Length:333 Identity:97/333 - (29%)
Similarity:145/333 - (43%) Gaps:54/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GEDQETQNQAMQDDGQPGGEGHHLSSEKQQSTEQCRQRPRKKLTDKQPQRSAANSHPEQADADTD 88
            |||::.|.  :.::...|.:|.:|:..        ||:|                   .|...|.
Human    13 GEDRKVQR--ISEEQARGQQGPNLAIG--------RQKP-------------------PAGVVTP 48

  Fly    89 SSSCEGIKVGQRRGTRVSYAQRNLHGAELEDYDYDGEGEGEREEDGEEEEEEEESYDDYEQSSKP 153
            .|..|...:.::|    |..:|.|.|:. :.....||..|        .|....|.:.......|
Human    49 KSDAEEPPLTRKR----SKKERGLRGSR-KRTGSSGEQTG--------PEAPGSSNNPPSTGEGP 100

  Fly   154 EGRRPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAF 218
            .|..|::....|.|...:.:...:..|:....     ||.|  .....|.|.:...::.|.:.||
Human   101 AGAPPASPGPASSRQSHRHRPDSLHDAAQRTY-----GPLL--NRVFGKDRELGPEELDELQAAF 158

  Fly   219 RLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKS 283
            ..||.|.||.|:..|||..||:||......||.|:.|.|.:...|.|.|||||:::.....|:.:
Human   159 EEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMRMGGRVDFEEFVELIGPKLREETA 223

  Fly   284 GLSSADQEERELRDAFRVFDKHNRGYITASDLR-AVLQCLGEDLDEEDIEDMIKEVDVDGDGRID 347
            .:...    ||||.|||.||:...|.||.::|| ||...|||.|...::::|::|||::|||.:|
Human   224 HMLGV----RELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEMLREVDLNGDGTVD 284

  Fly   348 FYEFVHAL 355
            |.|||..|
Human   285 FDEFVMML 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 28/61 (46%)
EF-hand_7 215..274 CDD:290234 27/58 (47%)
EFh 294..355 CDD:238008 31/61 (51%)
EF-hand_7 295..355 CDD:290234 30/60 (50%)
CABP4XP_011543483.1 PHA03415 81..>190 CDD:177643 30/123 (24%)
PTZ00184 145..294 CDD:185504 62/152 (41%)
EFh 153..214 CDD:238008 28/60 (47%)
EFh 230..293 CDD:238008 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.