DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and caln1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_021322021.1 Gene:caln1 / 562420 ZFINID:ZDB-GENE-130313-1 Length:262 Species:Danio rerio


Alignment Length:256 Identity:71/256 - (27%)
Similarity:107/256 - (41%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ELEDYDYDGEGEGEREEDGEEEEEEEESYDDYEQSSKPEGRRPSARTALSVRSRRKTKTRQICYA 180
            |:.:.|.|...||...::|.....:|....:|.......|.:......          |..:.|.
Zfish     2 EVTNLDPDPRAEGTEGDEGLGSPGKEPVVLEYAVDFDSYGEKMPFHHV----------TAGLLYK 56

  Fly   181 SSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFA 245
            .:.|...:.:..|   .|.|..   ||..::.|.|||||:.|:||:|.|:|:|||..|||||...
Zfish    57 GNFLSRSLSEHSN---SEQLAN---ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMP 115

  Fly   246 RVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAF------RVFDK 304
            ...||..::|.:|:||||.|.|:||:.||....      |||      |.|:.|      .:|.:
Zfish   116 SEVELAIIMQRLDMDGDGQVDFDEFMTILGPKL------LSS------ETREGFLGNTIDSIFWQ 168

  Fly   305 HNRGYITASDLRAVL-QCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEFVHALGEPEDSQEN 364
            .:...||..:|:.:| ....:.|..:|||::|                   :.|.|...||
Zfish   169 FDMQRITLEELKHILFHAFRDHLTMKDIENII-------------------INEEESLNEN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 33/61 (54%)
EF-hand_7 215..274 CDD:290234 31/58 (53%)
EFh 294..355 CDD:238008 13/67 (19%)
EF-hand_7 295..355 CDD:290234 12/66 (18%)
caln1XP_021322021.1 EFh_PEF 75..>185 CDD:330173 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.