DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cabp7b

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_683885.1 Gene:cabp7b / 556082 ZFINID:ZDB-GENE-060526-366 Length:213 Species:Danio rerio


Alignment Length:149 Identity:54/149 - (36%)
Similarity:84/149 - (56%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270
            :.:.::.|.||||::||:||:|.|:|:|||..|||||......||:.::|.:|:||||.|.||||
Zfish    30 LPEDEVEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEF 94

  Fly   271 VDILSNMTYEDKSGLSSADQEERELRDAF-RVFDKHNRGYITASDLRAVL-QCLGEDLDEEDIED 333
            |.:|.       ..||||...:|.....| .:|.|.:...:|..:|:.:| :...:.|..:|||:
Zfish    95 VALLG-------PKLSSAGMPDRFHGAEFDSIFWKCDMQKLTVDELKRLLYETFCDHLTMKDIEN 152

  Fly   334 MIK-----------EVDVD 341
            :|.           :||:|
Zfish   153 IIMTEESHLNSPECQVDID 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 34/61 (56%)
EF-hand_7 215..274 CDD:290234 33/58 (57%)
EFh 294..355 CDD:238008 14/61 (23%)
EF-hand_7 295..355 CDD:290234 14/60 (23%)
cabp7bXP_683885.1 EFh 37..98 CDD:238008 34/60 (57%)
EF-hand_7 38..98 CDD:290234 33/59 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.