DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cetn3

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001016387.1 Gene:cetn3 / 549141 XenbaseID:XB-GENE-1001054 Length:167 Species:Xenopus tropicalis


Alignment Length:158 Identity:52/158 - (32%)
Similarity:95/158 - (60%) Gaps:8/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 IDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDV 259
            :|.....|||.:::.|.:|.::||.|||.|.|..|...||...||:||...:..::.::|::.|.
 Frog    11 VDKTKKKKRRELTEEQKQEIKDAFELFDTDKDKAIDYHELKVAMRALGFDVKKADVLKILKDYDG 75

  Fly   260 DGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGE 324
            :..|.::|::|.::::::       :...|.:| |:..||::||..:.|.|:..:||.|.:.|||
 Frog    76 ETTGKITFDDFNEVVTDL-------ILDRDPQE-EILKAFKLFDDDDSGKISLRNLRRVARELGE 132

  Fly   325 DLDEEDIEDMIKEVDVDGDGRIDFYEFV 352
            ::.:|::..||:|.|.||||.|:..||:
 Frog   133 NMTDEELRAMIEEFDKDGDGEINQEEFL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 20/61 (33%)
EF-hand_7 215..274 CDD:290234 19/58 (33%)
EFh 294..355 CDD:238008 25/59 (42%)
EF-hand_7 295..355 CDD:290234 24/58 (41%)
cetn3NP_001016387.1 PTZ00183 15..166 CDD:185503 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.