DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Calm5

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:131 Identity:47/131 - (35%)
Similarity:77/131 - (58%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 DKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLS 286
            :::.||.|..:|||.||:.||:....|||:.::.::|.||||.:|||||...:...|        
Mouse     8 EENKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFFKSIKKYT-------- 64

  Fly   287 SADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEF 351
                :|:||:..|.|.|::..||||..:|:..|..:||.|.:|::|.||.....|.||::::.:|
Mouse    65 ----KEQELQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGADQDGKVNYEQF 125

  Fly   352 V 352
            :
Mouse   126 L 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 23/52 (44%)
EF-hand_7 215..274 CDD:290234 23/51 (45%)
EFh 294..355 CDD:238008 22/59 (37%)
EF-hand_7 295..355 CDD:290234 21/58 (36%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 21/45 (47%)
EFh 35..94 CDD:238008 24/70 (34%)
EF-hand_7 36..91 CDD:290234 23/66 (35%)
EFh 68..128 CDD:238008 22/59 (37%)
EF-hand_7 69..129 CDD:290234 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.