DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and tnnc1b

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001002085.1 Gene:tnnc1b / 415175 ZFINID:ZDB-GENE-040625-62 Length:161 Species:Danio rerio


Alignment Length:148 Identity:66/148 - (44%)
Similarity:97/148 - (65%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDG-DGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEE 269
            :::.|..|||.||.:|.:|. ||||:.:|||.|||.|||....||||||:.|:|.||.|.|.|:|
Zfish    12 LTEEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTQEELQEMVDEVDEDGSGTVDFDE 76

  Fly   270 FVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDM 334
            |:.::.....|:..|.|     |.||.:.||:|||:..|||...:|:.:|:..||.:.|:|||::
Zfish    77 FLVMMVRCMKEESKGKS-----EEELAEVFRMFDKNGDGYIDLDELKNMLESTGEAITEDDIEEL 136

  Fly   335 IKEVDVDGDGRIDFYEFV 352
            :|:.|.:.||:||:.||:
Zfish   137 MKDGDKNNDGKIDYDEFL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 35/62 (56%)
EF-hand_7 215..274 CDD:290234 33/59 (56%)
EFh 294..355 CDD:238008 26/59 (44%)
EF-hand_7 295..355 CDD:290234 25/58 (43%)
tnnc1bNP_001002085.1 PTZ00184 9..157 CDD:185504 66/148 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.