DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and tnnc2

DIOPT Version :10

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_012827046.1 Gene:tnnc2 / 394554 XenbaseID:XB-GENE-480259 Length:163 Species:Xenopus tropicalis


Alignment Length:73 Identity:15/73 - (20%)
Similarity:25/73 - (34%) Gaps:25/73 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NLVQNLFLILLVFCPAWILCKGKKKATYASVSKQTSSAEPAKSAIKPPITDPTPSAMAKVGSDEK 72
            :|:..|...|.:.|||                    |..|.:..::     .||.|..:.|:..|
 Frog    18 HLIGALLTFLCIICPA--------------------SGIPTQRDVQ-----QTPKANDQKGNQIK 57

  Fly    73 KEDPKDDK 80
            .:|..:.|
 Frog    58 FKDTTNRK 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504
tnnc2XP_012827046.1 PTZ00184 15..159 CDD:185504 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.