DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Cabp4

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_038941368.1 Gene:Cabp4 / 365394 RGDID:1306083 Length:278 Species:Rattus norvegicus


Alignment Length:331 Identity:96/331 - (29%)
Similarity:141/331 - (42%) Gaps:66/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QSTEQCRQRPRKKLTDKQPQRSAANSHPEQADADTDSSSCEGIKVGQRRGTRVSYAQRNLH---- 113
            :.:.|....|:|......|.||||                |...:.:||..:     .|.|    
  Rat     4 EHSAQLAPAPQKIPKGAVPPRSAA----------------EDPALTRRRSKK-----ENWHPGTQ 47

  Fly   114 --GAELEDYDYDGEGEGEREEDGEEEEEEEESYDDYEQSSKPEGRRPSARTALSVRSRRKTKTRQ 176
              .:|.:.:....|..|..:.....:..:|      |.||.|. |:.|.|.:...||..:....|
  Rat    48 KASSEEQSFSQSSEASGSSKNSSRTKVGQE------EPSSAPT-RQASHRQSHRHRSDPQQDAAQ 105

  Fly   177 ICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSL 241
            ..|           ||.|  .....|.|.:...::.|.:.||..||.|.||.|...|||..||:|
  Rat   106 RTY-----------GPLL--NRMFGKDRELGPEELEELQAAFEEFDTDQDGYIGHRELGDCMRTL 157

  Fly   242 GQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHN 306
            |......||.|:.|.:.:...|.|.|||||:::|....|:.:.:...    ||||.|||.|||..
  Rat   158 GYMPTEMELLEVSQHVKMRMGGFVDFEEFVELISPKLREETAHMLGV----RELRIAFREFDKDR 218

  Fly   307 RGYITASDLR-AVLQCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEFVHALGEPEDSQENDDEDVD 370
            .|.||.::|| |....|||.|:..::::|::::|::|||.|||        :.|...:.|     
  Rat   219 DGRITVAELRQAAPALLGEPLEGTELDEMLRDMDLNGDGTIDF--------DGESPLQTD----- 270

  Fly   371 TTSPLP 376
             |||:|
  Rat   271 -TSPMP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 27/61 (44%)
EF-hand_7 215..274 CDD:290234 26/58 (45%)
EFh 294..355 CDD:238008 27/61 (44%)
EF-hand_7 295..355 CDD:290234 26/60 (43%)
Cabp4XP_038941368.1 PTZ00184 133..262 CDD:185504 56/140 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.