DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Cabp5

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001102377.1 Gene:Cabp5 / 365194 RGDID:1308108 Length:173 Species:Rattus norvegicus


Alignment Length:152 Identity:57/152 - (37%)
Similarity:96/152 - (63%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 KRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVS 266
            :.|.:.:.::.|.||||..||||.||.|:.::||.:||::|......||.|:.|:|.::..|.|.
  Rat    21 RERPLGQDEIDELREAFLEFDKDRDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVD 85

  Fly   267 FEEFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQ-CLGEDLDEED 330
            ||:||::::.....:.:|:...    :|:||||:.||.:..|.||.::|:..:| .|||.|...:
  Rat    86 FEDFVELMTPKLLAETAGMIGV----QEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPRE 146

  Fly   331 IEDMIKEVDVDGDGRIDFYEFV 352
            |.::::|.|::|||.:||.|||
  Rat   147 IAEVVQEADINGDGTVDFEEFV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 28/61 (46%)
EF-hand_7 215..274 CDD:290234 27/58 (47%)
EFh 294..355 CDD:238008 27/60 (45%)
EF-hand_7 295..355 CDD:290234 26/59 (44%)
Cabp5NP_001102377.1 PTZ00184 25..171 CDD:185504 56/148 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.