DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Caln1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_017453894.1 Gene:Caln1 / 363909 RGDID:1305843 Length:293 Species:Rattus norvegicus


Alignment Length:245 Identity:72/245 - (29%)
Similarity:116/245 - (47%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 REEDGEEEEEEEESYDDYEQSSKPEGRRPSARTALSV----RSRRKTK----TRQICYASSDLEL 186
            |:...::..:.|.|:.:.:..:.|.|:.|....:|.:    ..|.|..    |..:.|..:.|..
  Rat    29 RQRGTKKPPKGERSHGEAQPLTSPPGKSPPNPKSLDLDCFATPREKMPFHHVTAGLLYKGNYLNR 93

  Fly   187 GIGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQ 251
            .:..|.   |.|.|..   ||..::.|.|||||:.|:||:|.|:|:|||..|||||......||.
  Rat    94 SLSAGS---DSEQLAN---ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA 152

  Fly   252 EMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLSSADQEERELRDAF------RVFDKHNRGYI 310
            .::|.:|:||||.|.|:||:.||....      :||      |.||.|      .:|.:.:...:
  Rat   153 IIMQRLDMDGDGQVDFDEFMTILGPKL------VSS------EGRDGFLGNTIDSIFWQFDMQRV 205

  Fly   311 TASDLRAVL-QCLGEDLDEEDIEDMIKEV-----DVDGDGRIDFYEFVHA 354
            |..:|:.:| ....:.|..:|||::|...     :..|:.:.:| |.||:
  Rat   206 TLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEF-EGVHS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 33/61 (54%)
EF-hand_7 215..274 CDD:290234 31/58 (53%)
EFh 294..355 CDD:238008 18/73 (25%)
EF-hand_7 295..355 CDD:290234 17/72 (24%)
Caln1XP_017453894.1 PTZ00184 106..>216 CDD:185504 46/124 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.