DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and azot

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:53/144 - (36%)
Similarity:90/144 - (62%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 EAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDI----LSN 276
            :.||:.|||.:|.||.:|:..|:|:||:.....|:|.|:.|:|.:|:|::...||.::    :.:
  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRD 78

  Fly   277 MTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVD 341
            ..:||            |||:|||:|||.|.||||.::|:.|...||..|.::::|:||:|.|:|
  Fly    79 TNHED------------ELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLD 131

  Fly   342 GDGRIDFYEFVHAL 355
            .|..:::.|||:.:
  Fly   132 QDNHLNYEEFVNMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 22/62 (35%)
EF-hand_7 215..274 CDD:290234 22/61 (36%)
EFh 294..355 CDD:238008 29/60 (48%)
EF-hand_7 295..355 CDD:290234 28/59 (47%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 53/144 (37%)
EFh 12..72 CDD:238008 22/57 (39%)
EFh 84..146 CDD:238008 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.