DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and TpnC25D

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:149 Identity:52/149 - (34%)
Similarity:86/149 - (57%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDIL 274
            :|...|:||::||....|.|....|.|::.|:||.....|||.::.:.|.:..|.|:|:.|..|.
  Fly     6 KMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCSIA 70

  Fly   275 SNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVD 339
            ::...|:     .|:..::||::|||::|:...||||.|.|:.:|..|.:.|...|::.:|.|:|
  Fly    71 AHFLEEE-----DAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEID 130

  Fly   340 VDGDGRIDFYEFVHAL-GE 357
            .||.|.:||.||:..: ||
  Fly   131 TDGSGTVDFDEFMEMMAGE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 21/61 (34%)
EF-hand_7 215..274 CDD:290234 20/58 (34%)
EFh 294..355 CDD:238008 26/60 (43%)
EF-hand_7 295..355 CDD:290234 25/59 (42%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 50/144 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.