DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CG31960

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:141 Identity:60/141 - (42%)
Similarity:94/141 - (66%) Gaps:8/141 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 REAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTY 279
            :..:.|.|||.:|.||.:|||.|:|:||:.....|:|.|:.|:|.||:|:::.|||.:::....:
  Fly    13 KNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNVILRKMH 77

  Fly   280 EDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDGDG 344
            :        ..:|.|||||||||||.|.|||:.::||||...|||.|:::::|:||:|.|:|.|.
  Fly    78 D--------TNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQDN 134

  Fly   345 RIDFYEFVHAL 355
            .|:|.||.:.:
  Fly   135 HINFEEFTNMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 25/59 (42%)
EF-hand_7 215..274 CDD:290234 25/58 (43%)
EFh 294..355 CDD:238008 34/60 (57%)
EF-hand_7 295..355 CDD:290234 33/59 (56%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 60/141 (43%)
EFh 12..72 CDD:238008 25/58 (43%)
EFh 84..146 CDD:238008 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.