DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and CG31802

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster


Alignment Length:151 Identity:47/151 - (31%)
Similarity:85/151 - (56%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEF 270
            :|..|..:.::||.|||....|.|..:||...:|:||...:.|:::.|:.|||.|..|.::|.:|
  Fly    39 LSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDF 103

  Fly   271 VDILSNMTYEDKSGLSSADQE-ERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDM 334
            :.::.         |..|::: .:::..||..||....|.|:..:|:.|.:.|||.|.:|::::|
  Fly   104 LYLMR---------LKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEM 159

  Fly   335 IKEVDVDGDGRIDFYEFVHAL 355
            |.|.:|.|||.:...||::.:
  Fly   160 IDEANVSGDGEVSKEEFLNLI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 21/61 (34%)
EF-hand_7 215..274 CDD:290234 21/58 (36%)
EFh 294..355 CDD:238008 22/60 (37%)
EF-hand_7 295..355 CDD:290234 22/59 (37%)
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 47/151 (31%)
EFh 46..108 CDD:238008 21/61 (34%)
EFh 119..181 CDD:238008 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.