DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and Tnnc1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001029277.1 Gene:Tnnc1 / 290561 RGDID:1309921 Length:161 Species:Rattus norvegicus


Alignment Length:148 Identity:67/148 - (45%)
Similarity:95/148 - (64%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ISKGQMREFREAFRLFDKDG-DGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEE 269
            :::.|..||:.||.:|.... ||||:.:|||.|||.|||....||||||:.|:|.||.|.|.|:|
  Rat    12 LTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDE 76

  Fly   270 FVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDM 334
            |:.::.....:|..|.|     |.||.|.||:|||:..|||...:|:.:||..||.:.|:|||::
  Rat    77 FLVMMVRCMKDDSKGKS-----EEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEEL 136

  Fly   335 IKEVDVDGDGRIDFYEFV 352
            :|:.|.:.|||||:.||:
  Rat   137 MKDGDKNNDGRIDYDEFL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 33/62 (53%)
EF-hand_7 215..274 CDD:290234 31/59 (53%)
EFh 294..355 CDD:238008 29/59 (49%)
EF-hand_7 295..355 CDD:290234 28/58 (48%)
Tnnc1NP_001029277.1 PTZ00184 9..157 CDD:185504 67/148 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.