DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cam1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:73/148 - (49%)
Similarity:97/148 - (65%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFE 268
            |.::..|:.||||||.|||:|.||.||..|||.|||||||.....|||:|:.|:|.||:|.:.|.
pombe     4 RNLTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFT 68

  Fly   269 EFVDILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIED 333
            ||:.:::..       :...|.|| |:|:||:||||...||||..:|..||..|||.|.:|::.|
pombe    69 EFLTMMARK-------MKDTDNEE-EVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVAD 125

  Fly   334 MIKEVDVDGDGRIDFYEF 351
            ||:|.|.||||.|::.||
pombe   126 MIREADTDGDGVINYEEF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 36/61 (59%)
EF-hand_7 215..274 CDD:290234 34/58 (59%)
EFh 294..355 CDD:238008 32/58 (55%)
EF-hand_7 295..355 CDD:290234 31/57 (54%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 72/147 (49%)
EFh 13..75 CDD:238008 36/61 (59%)
EFh 86..148 CDD:238008 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.