DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cam2

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:54/149 - (36%)
Similarity:80/149 - (53%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFV 271
            ||.|..|.:|||.|:|.|.||.|....:|:|:||||......||.::..|:   ||. :..::|:
pombe     4 SKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNEL---GDA-IDEKKFM 64

  Fly   272 DILSNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIK 336
            ..:||...|.:|        |.|...|||||||.|.|||..:.....::.|||.|.:.:::.|::
pombe    65 SFVSNKLRETES--------EEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQ 121

  Fly   337 EVDVDGDGRIDFYEFVHAL 355
            |.|....|..|:|:||..:
pombe   122 EADPTNSGSFDYYDFVQRI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 22/61 (36%)
EF-hand_7 215..274 CDD:290234 21/58 (36%)
EFh 294..355 CDD:238008 24/60 (40%)
EF-hand_7 295..355 CDD:290234 23/59 (39%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 54/149 (36%)
EFh 10..105 CDD:298682 39/106 (37%)
EFh 79..141 CDD:238008 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.