DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cal-8

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_495043.1 Gene:cal-8 / 184373 WormBaseID:WBGene00017394 Length:145 Species:Caenorhabditis elegans


Alignment Length:143 Identity:62/143 - (43%)
Similarity:91/143 - (63%) Gaps:8/143 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 EFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNM 277
            |.||.||.|||:|||.||::||...:..||:.|...:::.|:::.|:||:|.:..:||:::|...
 Worm     8 EIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNGCIDIDEFLNVLRRQ 72

  Fly   278 TYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDG 342
            ..:.|        |||||||.|.||||:..|.|:..||..|:..|||.|.|.:.::|||:.|:|.
 Worm    73 ICDPK--------EERELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDH 129

  Fly   343 DGRIDFYEFVHAL 355
            ||.|||.|||:.:
 Worm   130 DGMIDFQEFVNII 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 25/61 (41%)
EF-hand_7 215..274 CDD:290234 24/58 (41%)
EFh 294..355 CDD:238008 32/60 (53%)
EF-hand_7 295..355 CDD:290234 31/59 (53%)
cal-8NP_495043.1 PTZ00184 7..142 CDD:185504 62/141 (44%)
EFh 8..70 CDD:238008 25/61 (41%)
EFh 81..143 CDD:238008 32/62 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.