DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and E02A10.3

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:219 Identity:63/219 - (28%)
Similarity:115/219 - (52%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 RPSARTALSVRSR--RKTKTRQICYA-----SSDLELGIGDGPNLIDGETL--HKRRCISKGQMR 212
            ||.:|::..:|.:  :..|...:..|     .||  .|.|:.|:.|....|  |.....|:.:::
 Worm    75 RPFSRSSFMLRYKGDKSGKNHNVIDAIRLKLHSD--RGDGNSPHGIADPLLSQHLLEGYSEEELQ 137

  Fly   213 EFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNM 277
            |:|:.|.:||.|..|.|..:||...:::||.....:||.:::.|:|..|:..:.|:||..::..:
 Worm   138 EYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFCVVMRRL 202

  Fly   278 TYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDG 342
            |.: ||..:..      :::.|.|||:...|.|:..|.|.:|:.||:..|.:.|:::..|.||||
 Worm   203 TMK-KSNWNEV------VKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEADVDG 260

  Fly   343 DGRIDFYEFVHALGEPEDSQENDD 366
            :|.||:.||.:.:   ::...:||
 Worm   261 NGVIDYDEFTYMV---KNYMTDDD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 20/61 (33%)
EF-hand_7 215..274 CDD:290234 19/58 (33%)
EFh 294..355 CDD:238008 23/60 (38%)
EF-hand_7 295..355 CDD:290234 23/59 (39%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 47/147 (32%)
EF-hand motif 140..167 CDD:320054 9/26 (35%)
EF-hand motif 175..203 CDD:320054 7/27 (26%)
EF-hand motif 208..241 CDD:320054 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.