Sequence 1: | NP_569879.1 | Gene: | CG11638 / 31050 | FlyBaseID: | FBgn0040351 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256428.1 | Gene: | cal-1 / 179715 | WormBaseID: | WBGene00000285 | Length: | 180 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 78/196 - (39%) |
---|---|---|---|
Similarity: | 110/196 - (56%) | Gaps: | 29/196 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 159 SARTA--LSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLF 221
Fly 222 DKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLS 286
Fly 287 SADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEF 351
Fly 352 V 352 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11638 | NP_569879.1 | EFh | 213..275 | CDD:238008 | 33/61 (54%) |
EF-hand_7 | 215..274 | CDD:290234 | 31/58 (53%) | ||
EFh | 294..355 | CDD:238008 | 32/59 (54%) | ||
EF-hand_7 | 295..355 | CDD:290234 | 32/58 (55%) | ||
cal-1 | NP_001256428.1 | EFh_PEF | 36..177 | CDD:330173 | 71/166 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |