DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and cal-1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:196 Identity:78/196 - (39%)
Similarity:110/196 - (56%) Gaps:29/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SARTA--LSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLHKRRCISKGQMREFREAFRLF 221
            |:|.|  :::|:.|......:...|.|:...:  .|..||                ||||||.:|
 Worm     6 SSRLARDMAIRAERMAIPSNLMQFSEDIIKQL--TPEEID----------------EFREAFMMF 52

  Fly   222 DKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNMTYEDKSGLS 286
            ||||:|.|:.:|||..||||||....:|:.||:.|:|:||:|.:.|.||..::..|..|..|.: 
 Worm    53 DKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEFPEFCVMMKRMMKETDSEM- 116

  Fly   287 SADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEF 351
                    :|:|||||||...|.|||.:.|..:..:|....||::::|||||||||||.||:.||
 Worm   117 --------IREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEF 173

  Fly   352 V 352
            |
 Worm   174 V 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 33/61 (54%)
EF-hand_7 215..274 CDD:290234 31/58 (53%)
EFh 294..355 CDD:238008 32/59 (54%)
EF-hand_7 295..355 CDD:290234 32/58 (55%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 71/166 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.