DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and tnc-2

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_496251.1 Gene:tnc-2 / 174612 WormBaseID:WBGene00006583 Length:160 Species:Caenorhabditis elegans


Alignment Length:173 Identity:66/173 - (38%)
Similarity:109/173 - (63%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IGDGPNLIDGETLHKRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQE 252
            :||    :..:.|.|   :|..|:.:||:.|.:|||:|.|.|...::|.::|::||.....:|::
 Worm     1 MGD----VVADALEK---LSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQ 58

  Fly   253 MLQEIDVDGDGNVSFEEFVDILSN--MTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDL 315
            :::|.|.||.|.:.||||..:::|  :..|:..||      |.|||:|||::||...|||..|||
 Worm    59 LIKEFDADGSGEIEFEEFAAMVANFVVNNENDEGL------EEELREAFRLYDKEGNGYINVSDL 117

  Fly   316 RAVLQCLGEDLDEEDIEDMIKEVDVDGDGRIDFYEFVHAL-GE 357
            |.:|:.|.:::.||::::||.|:|.||.|.:||.||:..: ||
 Worm   118 RDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFMEMMSGE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 23/61 (38%)
EF-hand_7 215..274 CDD:290234 22/58 (38%)
EFh 294..355 CDD:238008 30/60 (50%)
EF-hand_7 295..355 CDD:290234 29/59 (49%)
tnc-2NP_496251.1 PTZ00184 10..157 CDD:185504 61/155 (39%)
EFh 19..81 CDD:238008 23/61 (38%)
EFh 96..158 CDD:238008 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.