DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11638 and si:cabz01076231.1

DIOPT Version :9

Sequence 1:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_021333321.1 Gene:si:cabz01076231.1 / 101886622 ZFINID:ZDB-GENE-160728-151 Length:218 Species:Danio rerio


Alignment Length:223 Identity:65/223 - (29%)
Similarity:118/223 - (52%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SYDDYEQSSKPEGR--RPSARTALSVRSRRKTKTRQICYASSDLELGIGDGPNLIDGETLH---- 201
            |.|..:.|...:|.  :|:.|.:....:.:|.|:::    |::      |..|.:....|:    
Zfish    10 STDSVKSSQSADGSAPKPALRKSPPGEANKKKKSKK----SNE------DAMNKVYTNLLNSVFG 64

  Fly   202 KRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVS 266
            :.|.:|:.::.|..|||:.||.|.||.:..::|...||::|......||.|::|:|.:...|.:.
Zfish    65 QERELSQPELDELAEAFKEFDYDQDGYLNYKDLAECMRTMGYMPTEMELLEIIQQIKMRLGGLMD 129

  Fly   267 FEEFVDILS-NMTYE--DKSGLSSADQEERELRDAFRVFDKHNRGYITASDLR-AVLQCLGEDLD 327
            |::|.:::. .|..|  |..||       :|::.:|..||....|.|:..::: ||...|||.|.
Zfish   130 FDDFCELMGPRMMVETADMLGL-------KEIKSSFCQFDTDGDGKISVDEMKEAVKNLLGEKLK 187

  Fly   328 EEDIEDMIKEVDVDGDGRIDFYEFVHAL 355
            :.::|:::||:|::|||.:||.|||..|
Zfish   188 KGELEEILKELDLNGDGTVDFDEFVMML 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11638NP_569879.1 EFh 213..275 CDD:238008 21/61 (34%)
EF-hand_7 215..274 CDD:290234 20/58 (34%)
EFh 294..355 CDD:238008 24/61 (39%)
EF-hand_7 295..355 CDD:290234 23/60 (38%)
si:cabz01076231.1XP_021333321.1 EFh_PEF 68..215 CDD:330173 51/153 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4848
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.