DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and TOA2

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_012865.1 Gene:TOA2 / 853807 SGDID:S000001541 Length:122 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:38/111 - (34%)
Similarity:60/111 - (54%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLETFR 67
            |:.||.:|:|.:|.|.||.::..|.|...:|..||..:||.::..|||:..|.::... .|:|:.
Yeast     7 YELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKG-NLDTYG 70

  Fly    68 CCDNVWTLILKDAEFR-EDQHS-------------LKVDVVKIVAC 99
            .||:|||.|:|:.:.. ||.|.             :.||.::||||
Yeast    71 FCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVAC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 17/46 (37%)
TOA2 3..103 CDD:227452 38/111 (34%)
TFIIA_gamma_C 53..99 CDD:280847 17/59 (29%)
TOA2NP_012865.1 TOA2 3..122 CDD:227452 38/111 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344997
Domainoid 1 1.000 46 1.000 Domainoid score I3061
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1597
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm46751
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.