DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and Gtf2a2

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_445797.1 Gene:Gtf2a2 / 83828 RGDID:620720 Length:109 Species:Rattus norvegicus


Alignment Length:106 Identity:52/106 - (49%)
Similarity:73/106 - (68%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLET 65
            |.||.||.||||.:||::|||:::...||.::|..|||::||:|::||.....:.::|... |.|
  Rat     1 MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGS-LNT 64

  Fly    66 FRCCDNVWTLILKDAEFREDQHSLKVDVVKIVACLGTDNGN 106
            :|.||||||.:|.|.||||....:|||.||||||.|.:.|:
  Rat    65 YRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 24/47 (51%)
TOA2 3..103 CDD:227452 50/99 (51%)
TFIIA_gamma_C 53..99 CDD:280847 23/45 (51%)
Gtf2a2NP_445797.1 TOA2 3..103 CDD:227452 50/100 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.