DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S-2 and AT4G24440

DIOPT Version :9

Sequence 1:NP_569877.1 Gene:TfIIA-S-2 / 31048 FlyBaseID:FBgn0040338 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_194175.1 Gene:AT4G24440 / 828546 AraportID:AT4G24440 Length:106 Species:Arabidopsis thaliana


Alignment Length:97 Identity:42/97 - (43%)
Similarity:64/97 - (65%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTAERLETFR 67
            ::.||.:|:|..|.:|||||::.|.::.::|..||:::|||::.||:....:.:|... .|.|:|
plant     4 FELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVKTKVSIKG-HLHTYR 67

  Fly    68 CCDNVWTLILKDAEFREDQHSLKVDVVKIVAC 99
            .||||||.||:||.|:.|.....|..||||||
plant    68 FCDNVWTFILQDAMFKSDDRQENVSRVKIVAC 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-S-2NP_569877.1 TFIIA_gamma_N 2..50 CDD:199901 19/46 (41%)
TOA2 3..103 CDD:227452 42/97 (43%)
TFIIA_gamma_C 53..99 CDD:280847 21/45 (47%)
AT4G24440NP_194175.1 TOA2 4..103 CDD:227452 42/97 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4273
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm3259
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.